Search
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
KCNH1 Polyclonal Antibody
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
FIGURE: 1 / 1
KCNH1 Antibody (PA5-95492) in WB
Western blot analysis of KCNH1 in Lane 1: human COLO-320 cell lysate, Lane 2: human HepG2 cell lysate, Lane 3: human A549 cell lysate. Electrophoresis was performed with 5-20% SDS-PAGE gel (70V, Stacking gel; 90V Resolving gel, Time: 2-3 hours), transferred to a nitrocellulose membrane and blocked using 5% Non-fat Milk/TBS (1.5 hrs at room temperature). Samples were incubated with KCNH1 polyclonal antibody (Product # PA5-95492) using a 0.5 µg/mL dilution, followed by a goat anti-rabbit IgG-HRP at a dilution of 1:10,000, and developed with ... View More
Product Details
PA5-95492
Product Specifications
Species Reactivity
Human,
Mouse,
Rat
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence of human KCNH1 (AKRKSWARFKDACGKSEDWNKVSKAESMETLPERTKA).
Conjugate
Form
Lyophilized
Concentration
500 µg/mL
Purification
Affinity chromatography
Storage buffer
PBS with 4mg trehalose
Contains
0.05mg sodium azide
Storage conditions
-20°C
Shipping conditions
Ambient (domestic); Wet ice (international)
RRID
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Positive Control - WB: human COLO-320 cell, human HepG2 cell, human A549 cell.|Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.
Target Information
Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. KCNH1 encodes a member of the potassium channel, voltage-gated, subfamily H. This member is a pore-forming (alpha) subunit of a voltage-gated non-inactivating delayed rectifier potassium channel. KCNH1 is activated at the onset of myoblast differentiation. KCNH1 is highly expressed in brain and in myoblasts. Overexpression of KCNH1 may confer a growth advantage to cancer cells and favor tumor cell proliferation. Alternative splicing of KCNH1 results in two transcript variants encoding distinct isoforms.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: EAG channel 1; EAG1; ether a go-go; Ether-a-go-go potassium channel 1; ether-a-go-go, Drosophila, homolog of; potassium channel, voltage gated eag related subfamily H, member 1; Potassium voltage-gated channel subfamily H member 1; potassium voltage-gated channel, subfamily H (eag-related), member 1; r-eag; Voltage-gated delayed rectifier potassium channel KCNH1; Voltage-gated potassium channel subunit Kv10.1
Gene Aliases: EAG; EAG1; h-eag; hEAG1; KCNH1; Kv10.1; M-eag; TMBTS; ZLS1
UniProt ID: (Human) O95259, (Rat) Q63472, (Mouse) Q60603
Entrez Gene ID: (Human) 3756, (Rat) 65198, (Mouse) 16510
phosphorelay sensor kinase activity
delayed rectifier potassium channel activity
protein binding
calmodulin binding
protein kinase binding
cyclic nucleotide binding
identical protein binding
ion channel binding
protein heterodimerization activity
14-3-3 protein binding
voltage-gated potassium channel activity
signal transducer activity
ion channel activity
voltage-gated ion channel activity
potassium channel activity
ion channel
phosphorelay signal transduction system
startle response
potassium ion transport
myoblast fusion
signal transduction by protein phosphorylation
regulation of ion transmembrane transport
regulation of cell proliferation
regulation of membrane potential
cellular response to calcium ion
potassium ion transmembrane transport
ion transmembrane transport
transport
ion transport
signal transduction
transmembrane transport
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support