Search
Search
Invitrogen
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
The immunogen sequence is: QFIKKAKEQEAEPEEQEEDSSSDPRLRRLQNRISEDVEERLARHRKIVEP
MFAP1 is a component of the elastin-associated microfibrils. Microfibrils, found either in association with elastin or independently, are an important component of the extracellular matrix of many tissues. MFAP1 is one of a number of proteins demonstrated to be essential for cell division.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Protein Aliases: microfibrillar-associated protein 1; Microfibrillar-associated protein 1A; Microfibrillar-associated protein 1B; Spliceosome B complex protein MFAP1A; Spliceosome B complex protein MFAP1B
Gene Aliases: 4432409M24Rik; Mfap1; Mfap1a; Mfap1b
UniProt ID: (Mouse) C0HKD8
Entrez Gene ID: (Mouse) 67532, (Mouse) 100034361
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support