Search
Invitrogen
SFTPA1/SFTPA2 Polyclonal Antibody
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
{{$ctrl.translations['antibody.pdp.skuNotes.additionalInformation']}}:
FIGURE: 1 / 7
SFTPA1/SFTPA2 Antibody (PA5-79987) in IHC (P)
Immunohistochemistry (Paraffin) analysis of SFTPA1/SFTPA2 in paraffin-embedded section of rat lung tissue using SFTPA1/SFTPA2 Polyclonal Antibody (Product # PA5-79987). Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with the primary antibody at a 5 µg/mL dilution over... View More
Please note: We are reviewing Western blot images included in the antibody testing data in our catalog, including those provided by third parties. Unless expressly labeled or annotated as “raw-unedited”, Western blot images included in the antibody testing data in our catalog may have been edited, optimized or otherwise adjusted for presentation.
Product Details
PA5-79987
Applications
Tested Dilution
Publications
Product Specifications
Species Reactivity
Human,
Mouse,
Rat
Published species
Mouse
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human SFTPA1/2 (206-237aa VNYTNWYRGEPAGRGKEQCVEMYTDGQWNDRN).
Conjugate
Unconjugated
Unconjugated
Unconjugated
Form
Lyophilized
Concentration
500 µg/mL once reconstituted
Amount
100 µg
Purification
Antigen affinity chromatography
Storage buffer
PBS with 5mg BSA
Contains
0.05mg sodium azide
Storage conditions
-20°C
Shipping conditions
Ambient (domestic); Wet ice (international)
RRID
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Positive Control - WB: rat lung tissue, mouse lung tissue. IHC: Mouse Lung tissue, Rat Lung tissue, Human Lung Cancer tissue IHC-F: Mouse Lung tissue, Rat Lung tissue.
Target Information
Surfactant protein A (SP-A) is synthesized and secreted by lung epithelial cells. It belongs to group III of the family of C-type lectins and members of this group has overall structure consisting of multiple globular 'head' regions linked by triple-helical, collagen-like, strands. This group also includes SP-D and the serum proteins mannan-binding protein, conglutinin and collectin-43, all of which have been shown to bind to the C1q receptor found on a wide variety of cells. Both SP-D and SP-A have been shown to enhance oxygen radical production by alveolar macrophages. The serum concentration is 45 ng/mL in healthy individuals.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Bioinformatics
Protein Aliases: 35 kDa pulmonary surfactant-associated protein; alveolar proteinosis protein; collectin 5; collectin-4; FLJ50593; FLJ51913; FLJ61144; FLJ77898; FLJ79095; FLJ99559; MGC133365; MGC198590; prepulmonary surfactant-associated protein A; PSAP; PSP-A; pulmonary surfactant protein A (56 could be 29); pulmonary surfactant-associated protein; pulmonary surfactant-associated protein A-like; SP-A2; surfactant protein A1B; surfactant pulmonary associated protein A1; surfactant, pulmonary-associated protein A1; surfactant, pulmonary-associated protein A1A; surfactant, pulmonary-associated protein A1B; surfactant, pulmonary-associated protein A2A; Surfactant-associated protein 1 (pulmonary surfactant protein, SP-A); unnamed protein product
Gene Aliases: COLEC4; COLEC5; ILD1; ILD2; PSAP; PSP-A; PSPA; Sftp-1; SFTP1; Sftpa; SFTPA1B; SFTPA2B; Sftpl; SP-2A; SP-A; SP-A1; SP-A1 beta; SP-A1 delta; SP-A1 epsilon; SP-A1 gamma; SPA; SPA1; SPA2; SPAII
UniProt ID: (Human) Q8IWL2, (Human) Q8IWL1, (Rat) P08427
Entrez Gene ID: (Human) 653509, (Human) 729238, (Mouse) 20387, (Rat) 24773
positive regulation of phagocytosis
opsonization
response to hypoxia
circadian rhythm
response to hormone
response to lipopolysaccharide
response to retinoic acid
response to vitamin A
response to glucocorticoid
response to hyperoxia
response to interleukin-6
response to epidermal growth factor
cellular response to mechanical stimulus
cellular response to nitric oxide
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support