Hamburger Menu Button
Thermo Fisher Scientific Logo
Sign in
Don't have an account ? Create Account
  • Products
    • PCR Equipment and Supplies
    • Chromatography Columns and Cartridges
    • Lab Centrifuges
    • Molecular Biology Reagents and Kits
    • Lab Plasticware and Supplies
    • See all product categories
  • Applications
    • Chromatography
    • Cell Culture
    • Real-Time PCR
    • Mass Spectrometry
    • Lab Plasticware and Supplies
    • Electron Microscopy
    • Protein Biology
    • PCR
    • RNAi
    • Environmental
    • See all applications and techniques
  • Services
    • Custom Services
    • Enterprise-Level Lab Informatics
    • Financial and Leasing Services
    • Instrument Services
    • OEM and Commercial Supply
    • Training Services
    • 360° CDMO and CRO Solutions
    • CDMO Services
    • CRO Services
    • Unity Lab Services
    • See all services
  • Help and Support
    • Learning Centers
    • Contact Us
    • Change Location
    • See all help and support topics
  • Popular
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • Who We Serve
    • Antibody Therapy Solution
    • Cell and Gene Therapy Solution
    • Academic
    • Industrial and Applied Sciences
  • New Products
  • Contact Us
  • Quick Order
  • Order Status and Tracking
  • Documents and Certificates
Thermo Fisher Scientific Logo

Search

Search All
Search button
          • Contact Us
          • Quick Order
          • Sign in
            Sign in
            Don't have an account ? Create Account
            • Account
            • Check Order Status
            • Membership
            • AR Statement & Invoice Inquiry
            • Custom Products & Projects
          • Primary Antibodies ›
          • STING Antibodies

          Invitrogen

          STING Polyclonal Antibody

          View all (50) STING antibodies

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support

          Cite STING Polyclonal Antibody

          {{$ctrl.translations['antibody.pdp.skuNotes.additionalInformation']}}:

          {{$ctrl.translations[$ctrl.isSkuNotesCollapsed ? 'antibody.pdp.skuNotes.viewMore' : 'antibody.pdp.skuNotes.viewLess']}}
          • Antibody Testing Data (2)
          STING Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Group 53 Created with Sketch.
          STING Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Group 53 Created with Sketch.

          FIGURE: 1 / 2

          {{ $ctrl.currentElement.advancedVerification.fullName }}
          {{ $ctrl.currentElement.advancedVerification.text }}

          STING Antibody (PA5-95268) in IHC (P)

          Immunohistochemistry analysis of STING in paraffin-embedded human lung cancer tissue. Samples were incubated with STING polyclonal antibody (Product # PA5-95268). {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
          Published figure supplied by benchsci-logo
          PMID: {{$ctrl.currentElement.benchSciPubmedId}}
          View Product

          {{$ctrl.videoDesc}}

          {{$ctrl.videoLongDesc}}

          STING Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          STING Antibody in Western Blot (WB)

          Please note: We are reviewing Western blot images included in the antibody testing data in our catalog, including those provided by third parties. Unless expressly labeled or annotated as “raw-unedited”, Western blot images included in the antibody testing data in our catalog may have been edited, optimized or otherwise adjusted for presentation.

          STING Polyclonal Antibody

          Product Details

          PA5-95268

          Applications
          Tested Dilution
          Publications

          Western Blot (WB)

          0.1-0.5 µg/mL
          -

          Immunohistochemistry (Paraffin) (IHC (P))

          0.5-1 µg/mL
          -
          Product Specifications

          Species Reactivity

          Human

          Host/Isotype

          Rabbit / IgG

          Class

          Polyclonal

          Type

          Antibody

          Immunogen

          A synthetic peptide corresponding to a sequence at the C-terminus of human TMEM173 (284-316aa RLEQAKLFCRTLEDILADAPESQNNCRLIAYQE).
          3D Epitope / Immunogen

          Conjugate

          Unconjugated Unconjugated Unconjugated

          Form

          Lyophilized

          Concentration

          500 µg/mL once reconstituted

          Amount

          100 µg

          Purification

          Affinity chromatography

          Storage buffer

          PBS with 5mg BSA

          Contains

          0.05mg sodium azide

          Storage conditions

          -20°C

          Shipping conditions

          Ambient (domestic); Wet ice (international)

          RRID

          AB_2807072

          Product Specific Information

          Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

          Positive Control - WB: Rat Thymus Tissue, Mouse Thymus Tissue. IHC: human lung cancer tissue.|Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

          Target Information

          STING is a 379 amino acid containing signaling protein that acts as an important component of innate immune signaling. This signaling protein is able to activate both NF-kappa-B and IRF3 transcription pathways to induce expression of type I interferon (IFN-alpha and IFN-beta) and exert a potent anti-viral state following expression. STING may have translocon function, the translocon possibly being able to influence the induction of type I interferons and is also involved in transduction of apoptotic signals via its association with the major histocompatibility complex class II (MHC-II) thus facilitating the detection of intracellular viral RNA species as well as B-form DNA and mediates death signaling via activation of the extracellular signal-regulated kinase (ERK) pathway. Generally seen in endoplasmic reticulum membrane, cell membrane and mitochondrion outer membrane, it is ubiquitously expressed in most of tissues.

          For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

          References (0)

          Have you cited this product in a publication?
          Let us know so we can reference it here.
          Cite this product

          Bioinformatics

          Protein Aliases: endoplasmic reticulum IFN stimulator; endoplasmic reticulum interferon stimulator; membrane protein; mitochondrial mediator of IRF3 activation; N-terminal methionine-proline-tyrosine-serine plasma membrane tetraspanner; stimulator of interferon protein; stimulator of interferon response cGAMP interactor-deltaC; stimulator of interferon response cGAMP interactor-deltaN; sting 1; STING-deltaC; STING-deltaN; tm173; transmembrane protein 173; transmembrane protein 173; TMEM173; unnamed protein product

          View more View less

          Gene Aliases: ERIS; hMITA; hSTING; MITA; MPYS; NET23; SAVI; STING; STING-beta; TMEM173

          View more View less

          UniProt ID: (Human) Q86WV6

          View more View less

          Entrez Gene ID: (Human) 340061

          View more View less

          Function(s)
          transcription coactivator activity protein binding hydrogen ion channel activity cholesterol binding protein kinase binding ubiquitin protein ligase binding cyclic-di-GMP binding signaling adaptor activity identical protein binding protein homodimerization activity cyclic-GMP-AMP binding RNA polymerase II sequence-specific DNA binding transcription factor binding phosphatidylinositol-3,5-bisphosphate binding protein serine/threonine kinase binding
          Process(es)
          autophagosome assembly positive regulation of cytokine production activation of innate immune response pattern recognition receptor signaling pathway positive regulation of defense response to virus by host cytoplasmic pattern recognition receptor signaling pathway autophagy positive regulation of macroautophagy positive regulation of type I interferon production positive regulation of interferon-beta production positive regulation of I-kappaB kinase/NF-kappaB signaling innate immune response negative regulation of glycolytic process positive regulation of transcription from RNA polymerase II promoter protein oligomerization defense response to virus lipid homeostasis positive regulation of type I interferon-mediated signaling pathway reticulophagy protein localization to endoplasmic reticulum cellular response to exogenous dsRNA cellular senescence antibacterial innate immune response antiviral innate immune response cGAS/STING signaling pathway hydrogen ion transmembrane transport negative regulation of TORC1 signaling positive regulation of lysosome organization
          It has to be done as per old AB suggested Products section.

          Disclaimer

          Close

          Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

          guarantee_icon

          Performance Guarantee

          If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

          Learn more
          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          Ordering Plus Icon Minus Icon
          • Order Status
          • Order Help
          • Quick Order
          • Supply Center
          • eProcurement
          Support Plus Icon Minus Icon
          • Help and Support
          • Contact Us - 400 820 8982
          • Instrument Quotation
          • Technical Support Centers
          • Documents and Certificates
          • Channel Partner Authorization
          • Report a Site Issue
          Resources Plus Icon Minus Icon
          • Learning Centers
          • Promotions
          • Events and Webinars
          • Social Media
          About Thermo Fisher Plus Icon Minus Icon
          • About Us About Us
          • Careers Careers
          • Investors Investors
          • News News
          • Social Responsibility Social Responsibility
          • Trademarks
          • Policies and Notices
          Our Portfolio Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Unity Lab Services
          • Patheon
          • PPD
          • Terms & Conditions
          • Privacy Notice
          • Price & Freight Policy
          © 2006-2026 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          China flag icon
          China
          本网站销售的所有产品均不得用于人类或动物之临床诊断或治疗,仅可用于工业或者科研等非医疗目的。
          经营证照公示 | ICP备案号:沪ICP备11003924号 | 沪公网安备 31011502006935号

          Your items have has been added!


          Host server : magellan-search-blue-7fb9f846c9-9j2pg:80/100.66.72.150:80.
          git-commit: 8207b5afa5c305bd40e0a4f0b9b53fd46f2a8829
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: release/2.59.1-2026.09.91-1.0