Hamburger Menu Button
Thermo Fisher Scientific Logo
Sign in
Don't have an account ? Create Account
  • Products
    • PCR Equipment and Supplies
    • Chromatography Columns and Cartridges
    • Lab Centrifuges
    • Molecular Biology Reagents and Kits
    • Lab Plasticware and Supplies
    • See all product categories
  • Applications
    • Chromatography
    • Cell Culture
    • Real-Time PCR
    • Mass Spectrometry
    • Lab Plasticware and Supplies
    • Electron Microscopy
    • Protein Biology
    • PCR
    • RNAi
    • Environmental
    • See all applications and techniques
  • Services
    • Custom Services
    • Enterprise-Level Lab Informatics
    • Financial and Leasing Services
    • Instrument Services
    • OEM and Commercial Supply
    • Training Services
    • 360° CDMO and CRO Solutions
    • CDMO Services
    • CRO Services
    • Unity Lab Services
    • See all services
  • Help and Support
    • Learning Centers
    • Contact Us
    • Change Location
    • See all help and support topics
  • Popular
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • Who We Serve
    • Antibody Therapy Solution
    • Cell and Gene Therapy Solution
    • Academic
    • Industrial and Applied Sciences
  • Contact Us
  • Quick Order
  • Order Status and Tracking
  • Documents and Certificates
Thermo Fisher Scientific Logo

Search

Search All
Search button
          • Contact Us
          • Quick Order
          • Sign in
            Sign in
            Don't have an account ? Create Account
            • Account
            • Check Order Status
            • Membership
            • AR Statement & Invoice Inquiry
            • Custom Products & Projects
          • Primary Antibodies ›
          • Aquaporin 1 Antibodies

          Invitrogen

          Aquaporin 1 Polyclonal Antibody

          3 Published Figures
          3 References
          View all (24) Aquaporin 1 antibodies

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support

          Cite Aquaporin 1 Polyclonal Antibody

          Additional Information:
          {{banner.description}}
          {{$ctrl.isSkuNotesCollapsed ? 'View more' : 'View less'}}
          • Antibody Testing Data (6)
          • Published Figures (3)
          Aquaporin 1 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Group 53 Created with Sketch.
          Aquaporin 1 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Group 53 Created with Sketch.

          FIGURE: 1 / 9

          {{ $ctrl.currentElement.advancedVerification.fullName }}
          {{ $ctrl.currentElement.advancedVerification.text }}

          Aquaporin 1 Antibody (PA5-78806) in IHC (P)

          Immunohistochemistry (Paraffin) analysis of Aquaporin 1 in paraffin-embedded section of rat kidney tissue using Aquaporin 1 Polyclonal Antibody (Product # PA5-78806). Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with the primary antibody at a 5 µg/mL dilution overni... View More {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
          Published figure supplied by benchsci-logo
          PMID: {{$ctrl.currentElement.benchSciPubmedId}}
          View Product

          {{$ctrl.videoDesc}}

          {{$ctrl.videoLongDesc}}

          Aquaporin 1 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Aquaporin 1 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Aquaporin 1 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Aquaporin 1 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Aquaporin 1 Antibody in Western Blot (WB)
          Aquaporin 1 Antibody in Flow Cytometry (Flow)
          Aquaporin 1 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Aquaporin 1 Antibody in Immunohistochemistry, Immunohistochemistry (Paraffin) (IHC, IHC (P))
          Aquaporin 1 Antibody in Flow Cytometry (Flow)

          Please note: We are reviewing Western blot images included in the antibody testing data in our catalog, including those provided by third parties. Unless expressly labeled or annotated as “raw-unedited”, Western blot images included in the antibody testing data in our catalog may have been edited, optimized or otherwise adjusted for presentation.

          Aquaporin 1 Polyclonal Antibody

          Product Details

          PA5-78806

          Applications
          Tested Dilution
          Publications

          Western Blot (WB)

          0.1-0.5 µg/mL
          -

          Immunohistochemistry (IHC)

          -
          View 1 publication 1 publication

          Immunohistochemistry (Paraffin) (IHC (P))

          2-5 µg/mL
          View 1 publication 1 publication

          Flow Cytometry (Flow)

          1-3 µg/1x10^6 cells
          View 1 publication 1 publication
          Product Specifications

          Species Reactivity

          Human, Mouse, Rat

          Published species

          Hamster, Mouse

          Host/Isotype

          Rabbit / IgG

          Class

          Polyclonal

          Type

          Antibody

          Immunogen

          A synthetic peptide corresponding to a sequence at the C-terminus of human Aquaporin 1 (240-269aa DRVKVWTSGQVEEYDLDADDINSRVEMKPK).
          3D Epitope / Immunogen

          Conjugate

          Unconjugated Unconjugated Unconjugated

          Form

          Lyophilized

          Concentration

          500 µg/mL

          Amount

          100 µg

          Purification

          Antigen affinity chromatography

          Storage buffer

          PBS with 4mg trehalose

          Contains

          no preservative

          Storage conditions

          -20°C

          Shipping conditions

          Ambient (domestic); Wet ice (international)

          RRID

          AB_2745922

          Product Specific Information

          Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

          Positive Control - WB: rat heart tissue, rat kidney tissue, rat lung tissue, mouse heart tissue, mouse kidney tissue, mouse lung tissue. IHC: human kidney tissue, mouse kidney tissue, rat kidney tissue. Flow: U2OS cell.

          Target Information

          Aquaporin 1 is a 28kD integral membrane protein which was originally identified in red blood cells and renal proximal tubules. AQP1 is also expressed by the choroid plexus and various other tissues. It forms a water-specific channel that provides the plasma membranes of red cells and kidney proximal tubules with high permeability to water, thereby permitting water to move in the direction of an osmotic gradient.

          For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

          Bioinformatics

          Protein Aliases: AQP 1; AQP CHIP; AQP-1; Aquaporin 1 (aquaporin channel forming integral protein 28 (CHIP)); Aquaporin CHIP; Aquaporin-1; Aquaporin-CHIP; Aquaporin1; Channel-like integral membrane protein of 28 kDa; CHIP 28; Colton blood group; Delayed early response protein 2; DER2; growth factor-induced delayed early response protein; MGC26324; Urine water channel; water channel protein for red blood cells and kidney proximal tubule

          View more View less

          Gene Aliases: AQP1; CHIP28

          View more View less

          UniProt ID: (Mouse) Q02013, (Rat) P29975

          View more View less

          Entrez Gene ID: (Mouse) 11826, (Rat) 25240

          View more View less

          Function(s)
          transporter activity intracellular cGMP activated cation channel activity potassium channel activity water transmembrane transporter activity ammonium transmembrane transporter activity potassium ion transmembrane transporter activity glycerol transmembrane transporter activity water channel activity glycerol channel activity transmembrane transporter activity nitric oxide transmembrane transporter activity carbon dioxide transmembrane transporter activity ephrin receptor binding protein binding transporter
          Process(es)
          glomerular filtration renal water transport cGMP biosynthetic process transport potassium ion transport water transport cell volume homeostasis cellular water homeostasis positive regulation of lamellipodium assembly positive regulation of epithelial cell migration carbon dioxide transport organic cation transport ammonium transport glycerol transport sensory perception of pain cellular homeostasis water homeostasis nitric oxide transport positive regulation of cell migration establishment or maintenance of actin cytoskeleton polarity secretion by cell secretory granule organization cellular response to stress carbohydrate transmembrane transport cellular response to UV transepithelial water transport carbon dioxide transmembrane transport wound healing response to drug negative regulation of apoptotic process negative regulation of cysteine-type endopeptidase activity involved in apoptotic process lipid digestion positive regulation of angiogenesis positive regulation of saliva secretion positive regulation of fibroblast proliferation camera-type eye morphogenesis corticotropin secretion transmembrane transport renal water absorption cellular response to hydrogen peroxide cellular response to inorganic substance cellular response to mechanical stimulus cellular response to copper ion cellular response to mercury ion cellular response to retinoic acid cellular response to cAMP cellular response to hypoxia cellular response to salt stress cellular hyperosmotic response cellular response to dexamethasone stimulus cellular response to nitric oxide potassium ion transmembrane transport ammonium transmembrane transport maintenance of symbiont-containing vacuole by host cation transmembrane transport hyperosmotic response response to hormone lateral ventricle development pancreatic juice secretion cerebrospinal fluid secretion odontogenesis hyperosmotic salinity response response to estrogen multicellular organismal water homeostasis metanephric descending thin limb development metanephric proximal straight tubule development metanephric proximal convoluted tubule segment 2 development metanephric glomerulus vasculature development
          It has to be done as per old AB suggested Products section.

          Disclaimer

          Close

          Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

          guarantee_icon

          Performance Guarantee

          If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

          Learn more
          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          Ordering Plus Icon Minus Icon
          • Order Status
          • Order Help
          • Quick Order
          • Supply Center
          • eProcurement
          Support Plus Icon Minus Icon
          • Help and Support
          • Contact Us - 400 820 8982
          • Technical Support Centers
          • Documents and Certificates
          • Report a Site Issue
          Resources Plus Icon Minus Icon
          • Learning Centers
          • Promotions
          • Events and Webinars
          • Social Media
          About Thermo Fisher Plus Icon Minus Icon
          • About Us About Us
          • Careers Careers
          • Investors Investors
          • News News
          • Social Responsibility Social Responsibility
          • Trademarks
          • Policies and Notices
          Our Portfolio Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Unity Lab Services
          • Patheon
          • PPD
          • Terms & Conditions
          • Privacy Policy
          • Price & Freight Policy
          © 2006-2026 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          China flag icon
          China
          本网站销售的所有产品均不得用于人类或动物之临床诊断或治疗,仅可用于工业或者科研等非医疗目的。
             电子营业执照 | 经营证照公示 | ICP备案号:沪ICP备11003924号 | 沪公网安备 31011502006935号

          Your items have has been added!


          Host server : magellan-search-green-dd86746ff-lmgjf:80/100.66.77.199:80.
          git-commit: 04e44c58f20fafe66519586ffe6db5d8a90e52ce
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: release/2.53.1-Offline