Hamburger Menu Button
Thermo Fisher Scientific Logo
Sign in
Don't have an account ? Create Account
  • Products
    • PCR Equipment and Supplies
    • Chromatography Columns and Cartridges
    • Lab Centrifuges
    • Molecular Biology Reagents and Kits
    • Lab Plasticware and Supplies
    • See all product categories
  • Applications
    • Chromatography
    • Cell Culture
    • Real-Time PCR
    • Mass Spectrometry
    • Lab Plasticware and Supplies
    • Electron Microscopy
    • Protein Biology
    • PCR
    • RNAi
    • Environmental
    • See all applications and techniques
  • Services
    • Custom Services
    • Enterprise-Level Lab Informatics
    • Financial and Leasing Services
    • Instrument Services
    • OEM and Commercial Supply
    • Training Services
    • 360° CDMO and CRO Solutions
    • CDMO Services
    • CRO Services
    • Unity Lab Services
    • See all services
  • Help and Support
    • Learning Centers
    • Contact Us
    • Change Location
    • See all help and support topics
  • Popular
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • Who We Serve
    • Antibody Therapy Solution
    • Cell and Gene Therapy Solution
    • Academic
    • Industrial and Applied Sciences
  • Contact Us
  • Quick Order
  • Order Status and Tracking
  • Documents and Certificates
Thermo Fisher Scientific Logo

Search

Search All
Search button
          • Contact Us
          • Quick Order
          • Sign in
            Sign in
            Don't have an account ? Create Account
            • Account
            • Check Order Status
            • Membership
            • AR Statement & Invoice Inquiry
            • Custom Products & Projects
          • Primary Antibodies ›
          • HMGB1 Antibodies

          Invitrogen

          HMGB1 Polyclonal Antibody

          Advanced Verification
          View all (55) HMGB1 antibodies

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support

          Cite HMGB1 Polyclonal Antibody

          Additional Information:

          {{$ctrl.isSkuNotesCollapsed ? 'View more' : 'View less'}}
          • Antibody Testing Data (13)
          • Advanced Verification (1)
          HMGB1 Antibody in Immunocytochemistry (ICC/IF)
          Group 53 Created with Sketch.
          HMGB1 Antibody in Immunocytochemistry (ICC/IF)
          Group 53 Created with Sketch.

          FIGURE: 1 / 14

          {{ $ctrl.currentElement.advancedVerification.fullName }}
          {{ $ctrl.currentElement.advancedVerification.text }}

          HMGB1 Antibody (PA5-79373) in ICC/IF

          Immunocytochemistry analysis of HMGB1 using anti-HMGB1 antibody (Product # PA5-79373). HMGB1 was detected in a section of A431 cells. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent for 15 mins. The cells were blocked with 10% goat serum and then incubated with 2μg/mL rabbit anti-HMGB1 antibody (Product # PA5-79373) overnight at 4°C. DyLight®594 Conjugated Goat Anti-Rabbit IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. Vi... View More {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
          Published figure supplied by benchsci-logo
          PMID: {{$ctrl.currentElement.benchSciPubmedId}}
          View Product

          {{$ctrl.videoDesc}}

          {{$ctrl.videoLongDesc}}

          HMGB1 Antibody in Immunocytochemistry (ICC/IF)
          HMGB1 Antibody in Immunocytochemistry (ICC/IF)
          HMGB1 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          HMGB1 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          HMGB1 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          HMGB1 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          HMGB1 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          HMGB1 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          HMGB1 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          HMGB1 Antibody in Western Blot (WB)
          HMGB1 Antibody in Western Blot (WB)
          HMGB1 Antibody in Western Blot (WB)
          HMGB1 Antibody in Flow Cytometry (Flow)
          HMGB1 Antibody

          Please note: We are reviewing Western blot images included in the antibody testing data in our catalog, including those provided by third parties. Unless expressly labeled or annotated as “raw-unedited”, Western blot images included in the antibody testing data in our catalog may have been edited, optimized or otherwise adjusted for presentation.

          HMGB1 Polyclonal Antibody

          Product Details

          PA5-79373

          Applications
          Tested Dilution
          Publications

          Western Blot (WB)

          0.1-0.5 µg/mL
          -

          Immunohistochemistry (Paraffin) (IHC (P))

          0.5-1 µg/mL
          -

          Immunocytochemistry (ICC/IF)

          2 µg/mL
          -

          Flow Cytometry (Flow)

          1-3 µg/1x10^6 cells
          -
          Product Specifications

          Species Reactivity

          Human, Mouse, Rat

          Host/Isotype

          Rabbit / IgG

          Class

          Polyclonal

          Type

          Antibody

          Immunogen

          A synthetic peptide corresponding to a sequence at the C-terminus of human HMGB1 (124-154aa DVAKKLGEMWNNTAADDKQPYEKKAAKLKEK).
          3D Epitope / Immunogen

          Conjugate

          Unconjugated Unconjugated Unconjugated

          Form

          Lyophilized

          Concentration

          500 µg/mL

          Amount

          100 µg

          Purification

          Antigen affinity chromatography

          Storage buffer

          PBS with 4mg trehalose

          Contains

          0.05mg sodium azide

          Storage conditions

          -20°C

          Shipping conditions

          Ambient (domestic); Wet ice (international)

          RRID

          AB_2746489

          Product Specific Information

          Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

          Positive Control - WB: human Hela whole cell, human 293T whole cell, human K562 whole cell, human Jurkat whole cell, rat brain tissue, mouse brain tissue, mouse RAW264.7 whole cell. IHC: mouse intestine tissue, mouse liver tissue, rat intestine tissue, rat liver tissue, human mammary cancer tissue, human placenta tissue,. ICC/IF: U20S cell, A431 cell. Flow: THP-1 cell.

          Target Information

          High-mobility group box 1 protein, previously known as HMG-1 or amphoterin, is a member of the high mobility group box family of non-histone chromosomal proteins. Human HMGB1 is expressed as a 30 kDa, 215 amino acid (aa) single chain polypeptide containing three domains: two N-terminal globular, 70 aa positively charged DNA-binding domains (HMG boxes A and B), and a negatively charged 30 aa C-terminal region that contains only Asp and Glu. HMGB1 is expressed at high levels in almost all cells. It was originally discovered as a nuclear protein that could bend DNA. Such bending stabilizes nucleosome formation and regulates the expression of select genes upon recruitment by DNA binding proteins. It is now known that HMGB1 can also act extracellularly, both as an inflammatory mediator that promotes monocyte migration and cytokine secretion, and as a mediator of T cell-dendritic cell interaction. Moreover, HMGB1 is reported that the level of HMGB1 is elevated during sterile tissue injury, infection, lethal endotoxemia or sepsis, collagen-induced arthritis, and ischemia-reperfusion induced tissue injury.

          For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

          References (0)

          Have you cited this product in a publication?
          Let us know so we can reference it here.
          Cite this product

          Bioinformatics

          Protein Aliases: Ac2-008-like; Amphoterin; Amphoterin antibody; DKFZp686A04236; heparin-binding protein p30; high mobility group 1; high mobility group protein 1; high-mobility group (nonhistone chromosomal) protein 1; HMG-1; HMG3 antibody; hmgb 1; hmgb-1; HMGB1; RP11-550P23.1; Sulfoglucuronyl carbohydrate binding protein; unnamed protein product

          View more View less

          Gene Aliases: Ac2-008; HMG-1; HMG1; HMG3; p30; SBP-1

          View more View less

          UniProt ID: (Human) P09429, (Rat) P63159, (Mouse) P63158

          View more View less

          Entrez Gene ID: (Human) 3146, (Rat) 25459, (Mouse) 15289

          View more View less

          Function(s)
          four-way junction DNA binding bubble DNA binding transcription regulatory region sequence-specific DNA binding lipopolysaccharide binding phosphatidylserine binding DNA binding damaged DNA binding double-stranded DNA binding single-stranded DNA binding transcription coactivator activity transcription corepressor activity RNA binding double-stranded RNA binding single-stranded RNA binding cytokine activity integrin binding protein binding DNA binding, bending calcium-dependent protein kinase regulator activity lyase activity C-X-C chemokine binding protein kinase activator activity chemoattractant activity receptor agonist activity RAGE receptor binding RNA polymerase II sequence-specific DNA binding transcription factor binding DNA polymerase binding supercoiled DNA binding DNA-binding transcription factor binding endodeoxyribonuclease activator activity open form four-way junction DNA binding crossed form four-way junction DNA binding nucleic acid binding bent DNA binding 5S rRNA binding heparin binding peptide binding non-sequence-specific DNA binding, bending protein heterodimerization activity glycolipid binding
          Process(es)
          negative regulation of transcription from RNA polymerase II promoter cell morphogenesis eye development myeloid dendritic cell activation positive regulation of protein phosphorylation endothelial cell proliferation positive regulation of mesenchymal cell proliferation activation of innate immune response plasmacytoid dendritic cell activation macrophage activation involved in immune response inflammatory response to antigenic stimulus regulation of tolerance induction MyD88-dependent toll-like receptor signaling pathway regulation of T cell mediated immune response to tumor cell DNA repair base-excision repair double-strand break repair double-strand break repair via nonhomologous end joining chromatin organization nucleosome assembly chromatin remodeling chemotaxis inflammatory response immune response positive regulation of cytosolic calcium ion concentration nervous system development memory circadian rhythm negative regulation of DNA replication cell proliferation positive regulation of cell proliferation response to xenobiotic stimulus response to glucose positive regulation of autophagy positive regulation of neuron projection development positive regulation of smooth muscle cell migration negative regulation of RNA polymerase II transcriptional preinitiation complex assembly actin cytoskeleton organization lung development positive regulation of cell migration neuron projection development heterochromatin assembly DNA geometric change positive regulation of mismatch repair response to lipopolysaccharide negative regulation of interferon-gamma production positive regulation of chemokine production positive regulation of interferon-alpha production positive regulation of interferon-beta production positive regulation of interleukin-1 beta production positive regulation of interleukin-1 production positive regulation of interleukin-10 production positive regulation of interleukin-12 production positive regulation of interleukin-6 production positive regulation of interleukin-8 production positive regulation of tumor necrosis factor production response to insulin positive regulation of myeloid cell apoptotic process V(D)J recombination toll-like receptor 2 signaling pathway positive regulation of toll-like receptor 2 signaling pathway toll-like receptor 4 signaling pathway positive regulation of toll-like receptor 4 signaling pathway positive regulation of toll-like receptor 9 signaling pathway response to interferon-gamma T-helper 1 cell activation endothelial cell chemotaxis psychomotor behavior positive regulation of activated T cell proliferation positive regulation of apoptotic process apoptotic cell clearance negative regulation of CD4-positive, alpha-beta T cell differentiation positive regulation of MAPK cascade positive regulation of blood vessel endothelial cell migration negative regulation of blood vessel endothelial cell migration T-helper 1 cell differentiation positive regulation of innate immune response response to ethanol positive regulation of cell differentiation positive regulation of myeloid cell differentiation positive regulation of myoblast differentiation positive regulation of glycogen catabolic process positive regulation of mitotic cell cycle positive regulation of transcription from RNA polymerase II promoter positive regulation of JNK cascade response to antibiotic male-specific defense response to bacterium induction of positive chemotaxis regulation of DNA metabolic process response to glucocorticoid neuron apoptotic process myoblast proliferation protein-containing complex assembly positive regulation of ERK1 and ERK2 cascade cellular response to lipopolysaccharide cellular response to cytokine stimulus cellular response to interleukin-1 positive regulation of monocyte chemotactic protein-1 production positive regulation of macrophage inflammatory protein 1 alpha production positive regulation of monocyte chemotaxis positive regulation of wound healing neutrophil clearance cellular response to interleukin-7 positive regulation of NIK/NF-kappaB signaling positive regulation of sprouting angiogenesis positive regulation of vascular endothelial cell proliferation positive regulation of chemokine (C-X-C motif) ligand 2 production negative regulation of apoptotic cell clearance regulation of nucleotide-excision repair positive regulation of dendritic cell differentiation positive regulation of endothelial cell proliferation dendritic cell chemotaxis DNA metabolic process DNA topological change DNA recombination signal transduction negative regulation of endothelial cell migration positive regulation of DNA binding positive regulation of viral entry into host cell regulation of viral process positive chemotaxis regulation of hemopoiesis
          It has to be done as per old AB suggested Products section.

          Disclaimer

          Close

          Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

          guarantee_icon

          Performance Guarantee

          If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

          Learn more
          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          Ordering Plus Icon Minus Icon
          • Order Status
          • Order Help
          • Quick Order
          • Supply Center
          • eProcurement
          Support Plus Icon Minus Icon
          • Help and Support
          • Contact Us - 400 820 8982
          • Technical Support Centers
          • Documents and Certificates
          • Report a Site Issue
          Resources Plus Icon Minus Icon
          • Learning Centers
          • Promotions
          • Events and Webinars
          • Social Media
          About Thermo Fisher Plus Icon Minus Icon
          • About Us About Us
          • Careers Careers
          • Investors Investors
          • News News
          • Social Responsibility Social Responsibility
          • Trademarks
          • Policies and Notices
          Our Portfolio Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Unity Lab Services
          • Patheon
          • PPD
          • Terms & Conditions
          • Privacy Policy
          • Price & Freight Policy
          © 2006-2026 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          China flag icon
          China
          本网站销售的所有产品均不得用于人类或动物之临床诊断或治疗,仅可用于工业或者科研等非医疗目的。
          经营证照公示 | ICP备案号:沪ICP备11003924号 | 沪公网安备 31011502006935号

          Your items have has been added!


          Host server : magellan-search-blue-74d7b4b4d9-zrl6d:80/100.66.77.38:80.
          git-commit: 7aafa54bd143a040505a257d2a3ebda4095a617f
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: release/2.56.0-Offline