Search
Invitrogen
Argonaute 4 Polyclonal Antibody
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
{{$ctrl.translations['antibody.pdp.skuNotes.additionalInformation']}}:
FIGURE: 1 / 1
Argonaute 4 Antibody (PA5-95363) in WB
Western blot analysis of Argonaute 4 in rat thymus extract (lane 1) and 22RV1 whole cell lysates (lane 2). Samples were incubated with Argonaute 4 polyclonal antibody (Product # PA5-95363) using a 0.5 µg/mL dilution. developed was performed using enhanced chemiluminescence (ECL).
Please note: We are reviewing Western blot images included in the antibody testing data in our catalog, including those provided by third parties. Unless expressly labeled or annotated as “raw-unedited”, Western blot images included in the antibody testing data in our catalog may have been edited, optimized or otherwise adjusted for presentation.
Product Details
PA5-95363
Product Specifications
Species Reactivity
Human,
Rat
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human Argonaute 4 (114-153aa KDQTFKVSVQWVSVVSLQLLLEALAGHLNEVPDDSVQALD).
Conjugate
Unconjugated
Unconjugated
Unconjugated
Form
Lyophilized
Concentration
500 µg/mL once reconstituted
Amount
100 µg
Purification
Affinity chromatography
Storage buffer
PBS with 4mg trehalose
Contains
0.05mg sodium azide
Storage conditions
-20°C
Shipping conditions
Ambient (domestic); Wet ice (international)
RRID
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Positive Control - WB: rat thymus tissue, 22RV1 whole cell.|Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.
Target Information
This gene encodes a member of the Argonaute family of proteins which play a role in RNA interference. The encoded protein is highly basic containing PAZ and PIWI domains, and it may play a role in short-interfering-RNA-mediated gene silencing.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: argonaute 4, RISC catalytic component; argonaute RISC catalytic component 4; eukaryotic translation initiation factor 2C, 4; protein argonaute-4-like; unnamed protein product
Gene Aliases: EIF2C4
UniProt ID: (Human) Q9HCK5
Entrez Gene ID: (Human) 192670, (Rat) 298533
mRNA catabolic process
pre-miRNA processing
posttranscriptional gene silencing by RNA
production of miRNAs involved in gene silencing by miRNA
miRNA mediated inhibition of translation
mRNA cleavage involved in gene silencing by miRNA
small RNA loading onto RISC
mRNA cleavage involved in gene silencing by siRNA
synaptonemal complex assembly
male meiosis
biological_process
male gonad development
miRNA metabolic process
regulation of cell morphogenesis
negative regulation of apoptotic process
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support