Search

  • Contact Us
  • Quick Order

Invitrogen

RAGE Monoclonal Antibody (5C6C1)

View all (23) RAGE antibodies

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

Datasheet
Certificates
Protocols
Questions & Answers
Tech Support
Datasheet
Certificates
Protocols
Questions & Answers
Tech Support
Datasheet
Certificates
Protocols
Questions & Answers
Tech Support
{{$ctrl.translations['antibody.pdp.skuNotes.additionalInformation']}}:

{{$ctrl.translations[$ctrl.isSkuNotesCollapsed ? 'antibody.pdp.skuNotes.viewMore' : 'antibody.pdp.skuNotes.viewLess']}}
RAGE Monoclonal Antibody (5C6C1)

Product Details

MA5-49253

Applications
Tested Dilution
Publications

Western Blot (WB)

0.25-0.5 µg/mL
-

Immunohistochemistry (Paraffin) (IHC (P))

2-5 µg/mL
-

Flow Cytometry (Flow)

1-3 µg/1x10^6 cells
-
Product Specifications

Species Reactivity

Human, Mouse, Rat

Host/Isotype

Mouse / IgG2b

Class

Monoclonal

Type

Antibody

Clone

5C6C1

Immunogen

A synthetic peptide corresponding to a sequence at the N-terminus of human RAGE (91-120aa IQDEGIFRCQAMNRNGKETKSNYRVRVYQI).
3D Epitope / Immunogen

Conjugate

Unconjugated Unconjugated Unconjugated

Form

Lyophilized

Concentration

500 µg/mL once reconstituted

Amount

100 µg

Purification

Antigen affinity chromatography

Storage buffer

PBS with 4mg trehalose

Contains

no preservative

Storage conditions

-20°C

Shipping conditions

Ambient (domestic); Wet ice (international)

RRID

AB_3074911

Product Specific Information

Adding 0.2 mL of distilled water will yield a concentration of 500 µg/mL.

Immunogen sequence is different from the related mouse and rat sequences by six amino acids.

Positive Control - WB: rat lung tissue, mouse lung tissue. IHC: mouse lung tissue, rat lung tissue, rat lung tissue. Flow: Jurkat cell.|Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

Target Information

The Receptor for Advanced Glycation End-products (RAGE) is a gene located on human chromosome 6p21.3, encoding a transmembrane receptor belonging to the immunoglobulin superfamily. RAGE is expressed in various tissues, with significant levels in the lungs, and plays a crucial role in cellular signaling and inflammation. As a receptor, RAGE binds multiple ligands, including advanced glycation end-products (AGEs), amyloid-beta peptide, high mobility group box 1 (HMGB1), and S100/calgranulin proteins, facilitating diverse pathological processes like inflammation, cancer progression, and neurodegeneration. The interaction between RAGE and its ligands triggers intracellular signaling pathways such as NF-kB activation, leading to inflammatory responses and oxidative stress. In the context of chronic diseases like diabetes, Alzheimer's, and cardiovascular diseases, RAGE is a critical mediator, linking metabolic disturbance to cellular dysfunction. Therapeutic targeting of RAGE signaling is under investigation, aiming to mitigate its contribution to inflammatory and degenerative diseases.

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

References (0)

Have you cited this product in a publication?
Let us know so we can reference it here.
Cite this product

Bioinformatics

Protein Aliases: advanced glycation end-products receptor; advanced glycosylation end product receptor; advanced glycosylation end product-specific receptor; RAGE-4 ORF3; RAGEdelex2-6; RAGEdelex3; RAGEdelex3-10; RAGEdelex3-7; RAGEdelex8&int9; RAGEint4; RAGEint4&9; RAGEint9&delex11; RAGEv1; RAGEv8; receptor for advanced glycation end products; receptor for advanced glycation end-products; receptor for advanced glycosylation end products; soluble receptor; sRAGE; unnamed protein product

View more View less

Gene Aliases: RAGE; SCARJ1; sRAGE

View more View less

UniProt ID: (Human) Q15109, (Mouse) Q62151

View more View less

Entrez Gene ID: (Human) 177, (Rat) 81722, (Mouse) 11596

View more View less

Function(s)
beta-amyloid binding DNA binding RNA binding transmembrane signaling receptor activity scavenger receptor activity protein binding signaling receptor activity histone binding identical protein binding S100 protein binding macromolecular complex binding advanced glycation end-product receptor activity binding, bridging high mobility group box 1 binding advanced glycation end-product binding
Process(es)
response to hypoxia microglial cell activation regulation of T cell mediated cytotoxicity negative regulation of protein phosphorylation positive regulation of protein phosphorylation negative regulation of endothelial cell proliferation phagocytosis response to stress inflammatory response negative regulation of cell adhesion cell surface receptor signaling pathway JAK-STAT cascade learning or memory memory positive regulation of cell proliferation response to fructose glucose mediated signaling pathway positive regulation of autophagy negative regulation of endothelial cell migration positive regulation of gene expression positive regulation of epithelial to mesenchymal transition positive regulation of fibroblast migration astrocyte development response to activity regulation of cell adhesion lung development positive regulation of cell migration neuron projection development negative regulation of interleukin-10 production positive regulation of chemokine production positive regulation of interleukin-1 beta production positive regulation of interleukin-12 production positive regulation of interleukin-6 production positive regulation of tumor necrosis factor production negative regulation of collagen biosynthetic process response to vitamin A response to genistein negative regulation of osteoblast proliferation positive regulation of heterotypic cell-cell adhesion intracellular signal transduction psychomotor behavior positive regulation of activated T cell proliferation positive regulation of apoptotic process positive regulation of JUN kinase activity positive regulation of neuron apoptotic process transcytosis response to ethanol positive regulation of cell differentiation positive regulation of JNK cascade response to antibiotic astrocyte activation positive regulation of fibroblast proliferation positive regulation of smooth muscle cell proliferation regulation of inflammatory response positive regulation of phagocytosis induction of positive chemotaxis positive regulation of multicellular organismal process response to methylglyoxal response to hyperoxia positive regulation of phagocytosis, engulfment transdifferentiation cellular response to hydrogen peroxide positive regulation of ERK1 and ERK2 cascade cellular response to glucose stimulus cellular response to fatty acid cellular response to xenobiotic stimulus positive regulation of monocyte chemotactic protein-1 production protein localization to membrane protein localization to plasma membrane response to selenite ion regulation of spontaneous synaptic transmission transport across blood-brain barrier regulation of long-term synaptic potentiation negative regulation of long-term synaptic potentiation negative regulation of long term synaptic depression regulation of p38MAPK cascade positive regulation of p38MAPK cascade positive regulation of NIK/NF-kappaB signaling positive regulation of potassium ion transmembrane transport positive regulation of amyloid precursor protein catabolic process negative regulation of blood circulation positive regulation of endothelin production negative regulation of connective tissue replacement involved in inflammatory response wound healing response to amyloid-beta cellular response to beta-amyloid positive regulation of vascular smooth muscle cell proliferation positive regulation of vascular associated smooth muscle cell migration positive regulation of DNA-dependent DNA replication positive regulation of endothelial cell apoptotic process positive regulation of reactive oxygen species metabolic process positive regulation of monocyte extravasation regulation of CD4-positive, alpha-beta T cell activation positive regulation of type B pancreatic cell apoptotic process positive regulation of double-strand break repair positive regulation of dendritic cell differentiation positive regulation of cytokine production positive regulation of smooth muscle cell migration positive regulation of signaling negative regulation of signaling negative regulation of cell migration positive regulation of locomotion positive regulation of DNA metabolic process negative regulation of multicellular organismal process cellular response to oxygen-containing compound response to wounding regulation of synaptic plasticity regulation of NIK/NF-kappaB signaling
guarantee_icon

Performance Guarantee

If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

Learn more
help_icon

We're here to help

Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

Contact tech support