Search
Invitrogen
CYP2D6 Polyclonal Antibody
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Additional Information:
{{banner.description}}
FIGURE: 1 / 5
CYP2D6 Antibody (PA5-79129) in IHC (P)
Immunohistochemistry analysis of CYP2D6 on paraffin-embedded human liver cancer tissue. Antigen retrieval was performed using citrate buffer (pH6, epitope retrieval solution) for 20 mins. Sample was blocked using 10% goat serum, incubated with CYP2D6 polyclonal antibody (Product# PA5-79129) with a dilution of 1 µg/mL (overnight at 4°C), and followed by biotinylated goat anti-rabbit IgG (30 minutes at 37°C).... View More
Please note: We are reviewing Western blot images included in the antibody testing data in our catalog, including those provided by third parties. Unless expressly labeled or annotated as “raw-unedited”, Western blot images included in the antibody testing data in our catalog may have been edited, optimized or otherwise adjusted for presentation.
Product Details
PA5-79129
Applications
Tested Dilution
Publications
Product Specifications
Species Reactivity
Human,
Mouse,
Rat
Published species
Mouse
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human Cytochrome P450 2D6 (315-347aa AWGLLLMILHPDVQRRVQQEIDDVIGQVRRPEM).
Conjugate
Unconjugated
Unconjugated
Unconjugated
Form
Lyophilized
Concentration
500 µg/mL
Amount
100 µg
Purification
Antigen affinity chromatography
Storage buffer
PBS with 4mg trehalose
Contains
0.05mg sodium azide
Storage conditions
-20°C
Shipping conditions
Ambient (domestic); Wet ice (international)
RRID
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Positive Control - WB: rat liver tissue, mouse liver tissue. IHC: rat intestine tissue, mouse liver tissue, human liver cancer tissue, mouse intestine tissue.
Target Information
Cytochrome p450 2D6 (CYP2D6) is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and is known to metabolize as many as 20% of commonly prescribed drugs. Its substrates include debrisoquine, an adrenergic-blocking drug; sparteine and propafenone, both anti-arrythmic drugs; and amitryptiline, an anti-depressant. The gene is highly polymorphic in the population; certain alleles result in the poor metabolizer phenotype, characterized by a decreased ability to metabolize the enzyme's substrates. The gene is located near two cytochrome P450 pseudogenes on chromosome 22q13.1. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Bioinformatics
Protein Aliases: Cholesterol 25-hydroxylase; CYPIID18; CYPIID3; CYPIID4; CYPIID6; Cytochrome P450 2D-29; Cytochrome P450 2D-35; Cytochrome P450 2D18; Cytochrome P450 2D3; Cytochrome P450 2D4; Cytochrome P450 2D6; cytochrome P450, family 2, subfamily d, polypeptide 13; cytochrome P450, family 2, subfamily d, polypeptide 22; cytochrome P450, family 2, subfamily d, polypeptide 4; cytochrome P450, family 2, subfamily d, polypeptide 6; cytochrome P450, subfamily 2D, polypeptide 6; cytochrome P450, subfamily IID, polypeptide 6; Cytochrome P450, subfamily IID3; Cytochrome P450, subfamily IID4; Cytochrome P450-CMF3; Cytochrome P450-DB1; Cytochrome P450-DB3; Cytochrome P450-DB4; Debrisoquine 4-hydroxylase; P450 2D-29/2D-35; P450-CMF3; P450-DB3; P450-DB4
Gene Aliases: Cyp2d-18; Cyp2d-3; Cyp2d-4; Cyp2d13; Cyp2d18; Cyp2d22; Cyp2d3; Cyp2d4; Cyp2d4v1; Cyp2d4v2; CYP2D6; CYP2DL1
UniProt ID: (Rat) P12938, (Rat) Q64680
Entrez Gene ID: (Rat) 24303, (Rat) 171522
monooxygenase activity
iron ion binding
arachidonic acid epoxygenase activity
steroid hydroxylase activity
oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen
oxygen binding
heme binding
aromatase activity
steroid 21-monooxygenase activity
drug binding
arachidonic acid monooxygenase activity
oxidoreductase activity
oxidoreductase
oxygenase
metabolite interconversion enzyme
liver development
xenobiotic metabolic process
arachidonic acid metabolic process
exogenous drug catabolic process
oxidation-reduction process
female pregnancy
steroid metabolic process
coumarin metabolic process
alkaloid metabolic process
alkaloid catabolic process
response to organic substance
monoterpenoid metabolic process
drug metabolic process
isoquinoline alkaloid metabolic process
dopamine biosynthetic process
dopamine metabolic process
drug catabolic process
heterocycle metabolic process
negative regulation of binding
oxidative demethylation
negative regulation of cellular organofluorine metabolic process
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support