Search
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Fabgennix
E2F1 Polyclonal Antibody, Biotin
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Product Details
E2F1N-BIOTIN
Applications
Tested Dilution
Publications
Product Specifications
Species Reactivity
Human,
Mouse,
Rat
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
Synthetic peptide corresponding to amino acids 58-93 of Human E2F1.Sequence:PCDPDLLLFATPQAPRPTPSAPRPALGRPPVKRRLD
Conjugate
Form
Liquid
Concentration
0.5-1.5 mg/mL
Purification
Affinity chromatography
Storage buffer
proprietary buffer, pH 7.4-7.8, with 0.5% BSA, 30% glycerol
Contains
0.02% sodium azide
Storage conditions
-20°C
Shipping conditions
Ambient (domestic); Wet ice (international)
Target Information
The protein encoded by this gene is a member of the E2F family of transcription factors. The E2F family plays a crucial role in the control of cell cycle and action of tumor suppressor proteins and is also a target of the transforming proteins of small DNA tumor viruses. The E2F proteins contain several evolutionally conserved domains found in most members of the family. These domains include a DNA binding domain, a dimerization domain which determines interaction with the differentiation regulated transcription factor proteins (DP), a transactivation domain enriched in acidic amino acids, and a tumor suppressor protein association domain which is embedded within the transactivation domain. This protein and another 2 members, E2F2 and E2F3, have an additional cyclin binding domain. This protein binds preferentially to retinoblastoma protein pRB in a cell-cycle dependent manner. It can mediate both cell proliferation and p53-dependent/independent apoptosis.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: E2F-1; PBR3; PRB-binding protein E2F-1; RBAP-1; RBBP-3; Retinoblastoma-associated protein 1; Retinoblastoma-binding protein 3; Transcription factor E2F1
Gene Aliases: E2F-1; E2F1; mKIAA4009; RBAP1; RBBP3; RBP3
UniProt ID: (Human) Q01094, (Mouse) Q80VZ3, (Rat) O09139
Entrez Gene ID: (Human) 1869, (Mouse) 13555, (Rat) 399489
core promoter binding
DNA binding
transcription factor activity, sequence-specific DNA binding
protein binding
transcription factor binding
protein kinase binding
sequence-specific DNA binding
transcription regulatory region DNA binding
RNA metabolism protein
nucleic acid metabolism protein
general transcription factor
DNA damage checkpoint
negative regulation of transcription from RNA polymerase II promoter
transcription, DNA-templated
regulation of transcription, DNA-templated
DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest
spermatogenesis
intrinsic apoptotic signaling pathway in response to DNA damage
positive regulation of gene expression
forebrain development
anoikis
negative regulation of DNA binding
negative regulation of fat cell differentiation
negative regulation of transcription, DNA-templated
positive regulation of transcription, DNA-templated
positive regulation of transcription from RNA polymerase II promoter
positive regulation of fibroblast proliferation
mRNA stabilization
negative regulation of fat cell proliferation
cellular response to fatty acid
cellular response to hypoxia
cellular response to xenobiotic stimulus
negative regulation of transcription involved in G1/S transition of mitotic cell cycle
intrinsic apoptotic signaling pathway by p53 class mediator
positive regulation of protein insertion into mitochondrial membrane involved in apoptotic signaling pathway
lens fiber cell apoptotic process
cellular response to nerve growth factor stimulus
regulation of G1/S transition of mitotic cell cycle
apoptotic process
cell cycle
regulation of cell cycle
G1/S transition of mitotic cell cycle
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support