Search
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
RUNX2 Polyclonal Antibody
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
FIGURE: 1 / 3
RUNX2 Antibody (PA5-95200) in ICC/IF
Immunocytochemistry analysis of RUNX2 using anti-RUNX2 antibody (Product # PA5-95200) . RUNX2 was detected in a section of A431 cells. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent for 15 mins. The cells were blocked with 10% goat serum and then incubated with 5μg/mL rabbit anti-RUNX2 antibody (Product # PA5-95200) overnight at 4°C. DyLight®488 Conjugated Goat Anti-Rabbit IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. V... View More
Product Details
PA5-95200
Applications
Tested Dilution
Publications
Product Specifications
Species Reactivity
Human
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human RUNX2 (244-278aa DRLSDLGRIPHPSMRVGVPPQNPRPSLNSAPSPFN).
Conjugate
Form
Lyophilized
Concentration
500 µg/mL
Purification
Affinity chromatography
Storage buffer
PBS with 5mg BSA
Contains
0.05mg sodium azide
Storage conditions
-20°C
Shipping conditions
Ambient (domestic); Wet ice (international)
RRID
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Positive Control - WB: human Hela whole cell, human A431 whole cell, human K562 whole cell, human Jurkat whole cell. ICC/IF: A431 cell.|Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.
Target Information
RUNX2, a nuclear protein, is a member of the RUNX family of transcription factors and has an Runt DNA-binding domain. It is essential for membranous and endochondral bone formation. It not only regulates osteoblastic differentiation and skeletal morphogenesis but also acts as a scaffold for nucleic acids and regulatory factors involved in skeletal gene expression. The protein can bind DNA both as a monomer and with more affinity, as a subunit of a heterodimeric complex. It plays a critical role in increasing TGFBR1 expression by osteoblasts and functions in cooperation with DLX5 or a related factor to activate osteoblast-specific gene expression. Mutations lead to disorders in bone development like cleidocranial dysplasia (CCD).
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: Acute myeloid leukemia 3 protein; AML-3; CBF-alpha-1; Core-binding factor subunit alpha-1; core-binding factor, runt domain, alpha subunit 1; Oncogene AML-3; OSF-2; Osteoblast-specific transcription factor 2; PEA2-alpha A; PEBP2-alpha A; Polyomavirus enhancer-binding protein 2 alpha A subunit; Runt-related transcription factor 2; RUNX 2; RUNX-2; SL3-3 enhancer factor 1 alpha A subunit; SL3/AKV core-binding factor alpha A subunit
Gene Aliases: AML3; CBF-alpha-1; CBFA1; CCD; CCD1; CLCD; OSF-2; OSF2; PEA2aA; PEBP2A; PEBP2aA; RUNX2
UniProt ID: (Human) Q13950
Entrez Gene ID: (Human) 860
RNA polymerase II core promoter proximal region sequence-specific DNA binding
RNA polymerase II core promoter sequence-specific DNA binding
RNA polymerase II transcription factor activity, sequence-specific DNA binding
transcriptional activator activity, RNA polymerase II core promoter proximal region sequence-specific binding
chromatin binding
transcription factor activity, sequence-specific DNA binding
protein binding
ATP binding
protein domain specific binding
histone deacetylase binding
bHLH transcription factor binding
repressing transcription factor binding
Runt transcription factor
ossification
osteoblast differentiation
endochondral ossification
osteoblast fate commitment
chondrocyte differentiation
chondrocyte development
osteoblast development
regulation of transcription from RNA polymerase II promoter
transcription from RNA polymerase II promoter
positive regulation of cell proliferation
hemopoiesis
neuron differentiation
T cell differentiation
BMP signaling pathway
positive regulation of chondrocyte differentiation
embryonic forelimb morphogenesis
regulation of fibroblast growth factor receptor signaling pathway
odontogenesis of dentin-containing tooth
regulation of odontogenesis of dentin-containing tooth
cellular response to fibroblast growth factor stimulus
regulation of cell differentiation
positive regulation of osteoblast differentiation
negative regulation of smoothened signaling pathway
negative regulation of transcription, DNA-templated
positive regulation of transcription, DNA-templated
cell maturation
embryonic cranial skeleton morphogenesis
stem cell differentiation
cellular response to BMP stimulus
positive regulation of transcription from RNA polymerase II promoter involved in cellular response to chemical stimulus
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support