Search
Invitrogen
RbAp48 Polyclonal Antibody
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Additional Information:
{{banner.description}}
FIGURE: 1 / 13
RbAp48 Antibody (PA5-95325) in ICC/IF
Immunocytochemistry/Immunofluorescence analysis of RbAp48 in U2OS cell using RbAp48 Polyclonal Antibody (Product # PA5-95325). Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent for 15 mins. The cells were blocked with 10% goat serum and incubated with the primary antibody at 2 µg/mL and mouse anti-Beta Tubulin antibody overnight at 4°C. DyLight 488 conjugated goat anti-rabbit IgG and DyLight 594 conjugated goat anti-mouse IgG were used as secondary antibody at 1:500 dilution and incubated for 30 minutes at 3... View More
Product Details
PA5-95325
Applications
Tested Dilution
Publications
Product Specifications
Species Reactivity
Human,
Mouse,
Rat
Published species
Human
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human RbAp48 (395-425aa EDNIMQVWQMAENIYNDEDPEGSVDPEGQGS).
Conjugate
Form
Lyophilized
Concentration
500 µg/mL
Amount
100 µg
Purification
Affinity chromatography
Storage buffer
PBS with 5mg BSA
Contains
0.05mg sodium azide
Storage conditions
-20°C
Shipping conditions
Ambient (domestic); Wet ice (international)
RRID
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Positive Control - WB: human Hela whole cell, human Raji whole cell, human Jurkat whole cell, human U87 whole cell, human HepG2 whole cell, human K562 whole cell, human RT4 whole cell, human A549 whole cell, rat brain tissue, rat liver tissue, rat lung tissue, rat RH35 whole cell, mouse brain tissue, mouse liver tissue, mouse lung tissue, mouse HEPA1-6 whole cell, rat brain tissue, rat liver tissue, rat lung tissue, rat RH35 whole cell, mouse brain tissue, mouse liver tissue, mouse liver tissue, mouse lung tissue, mouse HEPA1-6 whole cell. IHC: Human Intestinal Cancer tissue, Mouse Liver tissue, Rat Intestine tissue IHC-F: mouse small intestine tissue, rat small intestine tissue, mouse liver tissue, human placenta tissue. ICC/IF: U2OS cell, A431 cell. Flow: 293T cell.|Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.
Target Information
RbAp48-11G10 recognizes full length RbAp48, a 48 kDa nuclear protein first isolated by its ability to interact with the carboxyl-terminus of the retinoblastoma protein (Rb). It is a member of the WD (Trp-Asp) repeat family of proteins. RbAp48 is one of the three subunits of CAF-1, can bind to histone H4 and is a subunit of human histone deacetylase HD1.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Bioinformatics
Protein Aliases: CAF-1 p48 subunit; CAF-1 subunit C; CAF-I 48 kDa subunit; CAF-I p48; Chromatin assembly factor 1 subunit C; Chromatin assembly factor I p48 subunit; chromatin assembly factor/CAF-1 p48 subunit; Histone-binding protein RBBP4; MSI1 protein homolog; Nucleosome-remodeling factor subunit RBAP48; RBBP-4; Retinoblastoma-binding protein 4; Retinoblastoma-binding protein p48; unnamed protein product
Gene Aliases: lin-53; mRbAp48; NURF55; RBAP48; RBBP4
UniProt ID: (Human) Q09028, (Mouse) Q60972
Entrez Gene ID: (Human) 5928, (Rat) 313048, (Mouse) 19646
negative regulation of transcription from RNA polymerase II promoter
DNA replication
DNA repair
chromatin organization
nucleosome assembly
DNA replication-dependent nucleosome assembly
chromatin remodeling
regulation of transcription, DNA-templated
cellular response to DNA damage stimulus
brain development
negative regulation of cell proliferation
negative regulation of cell migration
negative regulation of transforming growth factor beta receptor signaling pathway
regulation of cell fate specification
negative regulation of transcription, DNA-templated
positive regulation of transcription, DNA-templated
negative regulation of stem cell population maintenance
positive regulation of stem cell population maintenance
regulation of stem cell differentiation
DNA replication-independent nucleosome assembly
metabolic process
chromatin assembly
ATP-dependent chromatin remodeling
response to growth hormone
transcription, DNA-templated
cell cycle
chromatin modification
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support