Search
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
GFI1 Polyclonal Antibody
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
FIGURE: 1 / 2
GFI1 Antibody (PA5-79305) in IHC (P)
Immunohistochemistry analysis of GFI1 on paraffin-embedded human mammary cancer tissue. Antigen retrieval was performed using citrate buffer (pH6, epitope retrieval solution) for 20 mins. Sample was blocked using 10% goat serum, incubated with GFI1 polyclonal antibody (Product# PA5-79305) with a dilution of 1 µg/mL (overnight at 4°C), and followed by biotinylated goat anti-rabbit IgG (30 minutes at 37°C). D... View More
Product Details
PA5-79305
Product Specifications
Species Reactivity
Human,
Mouse,
Rat
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence of human GFI1 (NLITHSRKHTGFKPFGCDLCGKGFQRKVDLRRHRETQH).
Conjugate
Form
Lyophilized
Concentration
500 µg/mL
Purification
Antigen affinity chromatography
Storage buffer
PBS with 4mg trehalose
Contains
0.05mg sodium azide
Storage conditions
-20°C
Shipping conditions
Ambient (domestic); Wet ice (international)
RRID
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Positive Control - IHC: human mammary cancer tissue, human rectal cancer tissue.
Target Information
GFI1 is a nuclear zinc finger (ZF) transcriptional repressor that plays an important role in hematopoiesis and inner ear development, and has been implicated in lymphomagenesis. The Gfi1 protein expression is regulated by the ubiquitin-proteasome system. It is reported that ubiquitin ligase Triad1 interacts with the DNA-binding domain of Gfi-1. Gfi-1 represses transcription by directly binding to the consensus DNA sequence in the promoters of its target genes. Deficiency of Gfi-1 causes neutropenia and an accumulation of granulomonocytic precursor cells that is reminiscent of a myelodysplastic syndrome in mice.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: FLJ94509; growth factor independence-1; growth factor independent 1 transcription repressor; Growth factor independent protein 1; Growth factor independent-1; Zinc finger protein 163; Zinc finger protein Gfi-1
Gene Aliases: AW495828; GFI-1; GFI1; GFI1A; Pal-1; Pal1; SCN2; ZNF163
UniProt ID: (Human) Q99684, (Rat) Q07120, (Mouse) P70338
Entrez Gene ID: (Human) 2672, (Rat) 24388, (Mouse) 14581
transcriptional repressor activity, RNA polymerase II core promoter proximal region sequence-specific binding
protein binding
transcription regulatory region DNA binding
metal ion binding
zinc ion binding
RNA polymerase II regulatory region sequence-specific DNA binding
RNA polymerase II transcription factor activity, sequence-specific DNA binding
nucleic acid binding
DNA binding
C2H2 zinc finger transcription factor
regulation of transcription involved in G1/S transition of mitotic cell cycle
negative regulation of transcription from RNA polymerase II promoter
transcription, DNA-templated
negative regulation of calcidiol 1-monooxygenase activity
negative regulation of vitamin D biosynthetic process
negative regulation of neuron projection development
viral process
myeloid cell differentiation
negative regulation of NF-kappaB transcription factor activity
regulation of toll-like receptor signaling pathway
negative regulation of transcription, DNA-templated
regulation of histone H3-K4 methylation
positive regulation of interleukin-6-mediated signaling pathway
cellular response to lipopolysaccharide
mechanosensory behavior
negative regulation of cell fate specification
inner ear morphogenesis
auditory receptor cell differentiation
positive regulation of cell fate specification
cell fate commitment
regulation of transcription, DNA-templated
transcription from RNA polymerase II promoter
regulation of neurogenesis
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support