Search
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
SOX5 Polyclonal Antibody
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
FIGURE: 1 / 6
SOX5 Antibody (PA5-95266) in WB
Western blot analysis of SOX5 in Lane 1: rat liver tissue lysate (50 µg), Lane 2: rat testis tissue lysate (50 µg), Lane 3: rat brain tissue lysate (50 µg), Lane 4: HeLa whole cell lysate (40 µg), Lane 5: A549 whole cell lysate (40 µg). Samples were incubated with SOX5 polyclonal antibody (Product # PA5-95266).
Product Details
PA5-95266
Applications
Tested Dilution
Publications
Product Specifications
Species Reactivity
Human,
Mouse,
Pig,
Rat
Published species
Human
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human SOX5 (495-528aa EKEKTTLESLTQQLAVKQNEEGKFSHAMMDFNLS).
Conjugate
Form
Lyophilized
Concentration
500 µg/mL
Purification
Affinity chromatography
Storage buffer
PBS with 5mg BSA
Contains
0.05mg sodium azide
Storage conditions
-20°C
Shipping conditions
Ambient (domestic); Wet ice (international)
RRID
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Positive Control - WB: Rat Liver Tissue, Rat Testis Tissue, Rat Brain Tissue, HELA whole cell, A549 whole cell, All lanes: pig adipose cells, mouse spleen tissue, mouse thymus tissue.|Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.
Target Information
This gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. The encoded protein may play a role in chondrogenesis. A pseudogene of this gene is located on chromosome 8. Multiple transcript variants encoding distinct isoforms have been identified for this gene.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Bioinformatics
Protein Aliases: MGC35153; Sox5-BLM isoform; SRY (sex determining region Y)-box 5; SRY box 5; SRY-box 5; SRY-box containing gene 5; SRY-box containing gene 5-like 1; SRY-related HMG-box 5 protein; Transcription factor SOX-5
Gene Aliases: A730017D01Rik; AI528773; L-SOX5; L-SOX5B; L-SOX5F; LAMSHF; Sox-5; SOX5; Sox5l1
UniProt ID: (Human) P35711, (Rat) F1M8W4, (Mouse) P35710
Entrez Gene ID: (Human) 6660, (Pig) 100627965, (Rat) 140587, (Mouse) 20678
regulation of transcription, DNA-templated
transcription from RNA polymerase II promoter
positive regulation of chondrocyte differentiation
asymmetric neuroblast division
positive regulation of cartilage development
cellular response to transforming growth factor beta stimulus
positive regulation of mesenchymal stem cell differentiation
in utero embryonic development
central nervous system neuron differentiation
cell fate commitment
negative regulation of transcription, DNA-templated
positive regulation of transcription from RNA polymerase II promoter
oligodendrocyte differentiation
cartilage development
regulation of timing of neuron differentiation
transcription, DNA-templated
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support