Search
Invitrogen
14-3-3 zeta Monoclonal Antibody (6G5)
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
FIGURE: 1 / 3
14-3-3 zeta Antibody (MA5-49184) in WB
Western blot analysis of 14-3-3 zeta/delta using 14-3-3 zeta/delta antibody (Product # MA5-49184). Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50 µg of sample under reducing conditions. Lane 1: human Hela whole cell lysates; Lane 2: human A549 whole cell lysates; Lane 3: monkey COS-7 whole cell lysates; Lane 4: human Raji whole cell lysates; Lane 5:huamn Caco-2 whole cell lysates; Lane 6: human Jurkat whole cell lysates; Lane 7... View More
Please note: We are reviewing Western blot images included in the antibody testing data in our catalog, including those provided by third parties. Unless expressly labeled or annotated as “raw-unedited”, Western blot images included in the antibody testing data in our catalog may have been edited, optimized or otherwise adjusted for presentation.
Product Details
MA5-49184
Applications
Tested Dilution
Publications
Product Specifications
Species Reactivity
Human,
Mouse,
Non-human primate,
Rat
Host/Isotype
Mouse
/ IgG2b
Class
Monoclonal
Type
Antibody
Clone
6G5
Immunogen
A synthetic peptide corresponding to a sequence of human 14-3-3 zeta/delta (LLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQ).
Conjugate
Unconjugated
Unconjugated
Unconjugated
Form
Lyophilized
Concentration
500 µg/mL
Amount
100 µg
Purification
Antigen affinity chromatography
Storage buffer
PBS with 4mg trehalose
Contains
0.05mg sodium azide
Storage conditions
-20°C
Shipping conditions
Ambient (domestic); Wet ice (international)
RRID
Product Specific Information
Adding 0.2 mL of distilled water will yield a concentration of 500 µg/mL.
Positive Control - WB: human Hela whole cell, human A549 whole cell, monkey COS-7 whole cell, human Raji whole cell, PC-3 cell, SiHa cell.|Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.
Target Information
At least seven isoforms comprise the highly conserved 14-3-3 family of homo- and heterodimeric proteins that are abundantly expressed in all eukaryotic cells. Although more than seven isoforms of 14-3-3 have been described, some redundancies have appeared upon sequencing. The 14-3-3s are thought to be key regulators of signal transduction events mediated through their binding to serine-phosphorylated proteins. By interacting with Cdc25C, 14-3-3 regulates entry into the cell cycle and through interaction with Bad, prevents apoptosis. Other proteins that have been shown to bind to 14-3-3s include members of the protein kinase C family, Cbl, IRS-1, polyoma middle-T antigen, nitrate reductase, S-raf and the IGF-1 receptor. Detection of 14-3-3 proteins in cerebrospinal fluid has been shown to be useful in the differential diagnosis of Creutzfeldt-Jakob disease and other prion diseases.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: 14-3-3 delta; 14-3-3 protein/cytosolic phospholipase A2; 14-3-3 zeta; 1433Z; 143Z; epididymis luminal protein 4; epididymis secretory protein Li 3; epididymis secretory protein Li 93; KCIP-1; mitochondrial import stimulation factor S1 subunit; phospholipase A2; protein kinase C inhibitor protein 1; protein kinase C inhibitor protein-1; SEZ-2; tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, delta polypeptide; tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide; tyrosine 3/tryptophan 5 -monooxygenase activation protein, zeta polypeptide; unnamed protein product
Gene Aliases: 1110013I11Rik; 14-3-3-zeta; 14-3-3z; 14-3-3zeta; HEL-S-3; HEL-S-93; HEL4; KCIP-1; POPCHAS; YWHAD
UniProt ID: (Human) P63104, (Mouse) P63101, (Rat) P63102
Entrez Gene ID: (Human) 7534, (Mouse) 22631, (Rat) 25578
RNA binding
protein binding
protein kinase binding
protein phosphatase binding
protein domain specific binding
ubiquitin protein ligase binding
identical protein binding
ion channel binding
cadherin binding
phosphoserine binding
DNA-binding transcription factor binding
protein sequestering activity
macromolecular complex binding
negative regulation of transcription from RNA polymerase II promoter
angiogenesis
respiratory system process
protein phosphorylation
signal transduction
synaptic target recognition
protein localization
lung development
regulation of protein stability
tube formation
cellular response to glucose starvation
negative regulation of apoptotic process
negative regulation of innate immune response
establishment of Golgi localization
regulation of ERK1 and ERK2 cascade
regulation of synapse maturation
Golgi reassembly
negative regulation of protein localization to nucleus
negative regulation of TORC1 signaling
histamine secretion by mast cell
protein targeting
lysosome organization
response to xenobiotic stimulus
cellular response to nutrient levels
TORC1 signaling
regulation of programmed cell death
establishment of protein localization
ERK1 and ERK2 cascade
protein localization to mitochondrion
antibacterial innate immune response
regulation of lysosome organization
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support