Search
Invitrogen
HTR2A Polyclonal Antibody
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Additional Information:
{{banner.description}}
FIGURE: 1 / 4
HTR2A Antibody (PA5-95288) in IHC (P)
Immunohistochemistry analysis of HTR2A in paraffin-embedded human glioma tissue. Antigen retrieval was performed on the tissue using citrate buffer (pH 6, 20 min) and blocked with 10% goat serum. Samples were incubated with HTR2A polyclonal antibody (Product # PA5-95288) at a 1 µg/mL dilution, followed by biotinylated goat anti-rabbit IgG (30 min, 37°C), and developed with Strepavidin-Biotin-Complex and DAB... View More
Please note: We are reviewing Western blot images included in the antibody testing data in our catalog, including those provided by third parties. Unless expressly labeled or annotated as “raw-unedited”, Western blot images included in the antibody testing data in our catalog may have been edited, optimized or otherwise adjusted for presentation.
Product Details
PA5-95288
Applications
Tested Dilution
Publications
Product Specifications
Species Reactivity
Human,
Rat
Published species
Rat
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human 5HT2A Receptor (400-431aa KENKKPLQLILVNTIPALAYKSSQLQMGQKKN) .
Conjugate
Unconjugated
Unconjugated
Unconjugated
Form
Lyophilized
Concentration
500 µg/mL
Amount
100 µg
Purification
Affinity chromatography
Storage buffer
4mg trehalose, 0.9mg NaCl, 0.2mg Na2PO4
Contains
no preservative
Storage conditions
-20°C
Shipping conditions
Ambient (domestic); Wet ice (international)
RRID
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Positive Control - WB: Rat Brain Tissue, Rat Testis Tissue, U87 whole cell. IHC: human glioma tissue, rat brain tissue.|Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.
Target Information
In platelets and gut, serotonin plays a major role in cardiovascular function and motility of the gastrointestinal tract, respectively. Serotonin mediates its effects through several of G protein coupled receptors, designated 5-HT receptors or alternatively SR receptors. The SR-2 receptors are comprised of three subtypes, SR-2A, SR-2B and SR-2C, which activate phospholipase C and release intracellular stores of calcium in response to serotonin. SR-2A has a specific role in tracheal smooth muscle contraction, bronchoconstriction and mediating aldosterone production, and it is also thought to play a role in several psychiatric disorders, including depression and schizophrenia. SR-2B is expressed in embryonic and adult cardiovascular tissues, gut and brain and plays an important role in the pathology of cardiac disorders. SR-2C is thought to mediate the effects of atypical antipsychotic drugs.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Bioinformatics
Protein Aliases: 5-HT-2; 5-HT-2A; 5-HT2A/2C; 5-HT2A/2C receptor; 5-hydroxytryptamine receptor 2A; 5HT2A Receptor; serotonin 5HT-2 receptor; Serotonin receptor 2A; SR2A
Gene Aliases: 5-HT2A; 5Ht-2; Htr2; Htr2a
UniProt ID: (Rat) P14842
Entrez Gene ID: (Rat) 29595
temperature homeostasis
cellular calcium ion homeostasis
G-protein coupled receptor signaling pathway
activation of phospholipase C activity
positive regulation of cytosolic calcium ion concentration
phospholipase C-activating serotonin receptor signaling pathway
serotonin receptor signaling pathway
aging
memory
cell death
positive regulation of cell proliferation
positive regulation of phosphatidylinositol biosynthetic process
regulation of dopamine secretion
phosphatidylinositol 3-kinase signaling
artery smooth muscle contraction
urinary bladder smooth muscle contraction
sensory perception of pain
sleep
positive regulation of kinase activity
response to drug
negative regulation of potassium ion transport
positive regulation of MAP kinase activity
protein localization to cytoskeleton
positive regulation of fat cell differentiation
positive regulation of glycolytic process
positive regulation of vasoconstriction
regulation of hormone secretion
behavioral response to cocaine
positive regulation of peptidyl-tyrosine phosphorylation
regulation of behavior
detection of temperature stimulus involved in sensory perception of pain
detection of mechanical stimulus involved in sensory perception of pain
release of sequestered calcium ion into cytosol
negative regulation of synaptic transmission, glutamatergic
positive regulation of ERK1 and ERK2 cascade
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support