Search
Invitrogen
SIX3 Polyclonal Antibody
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Additional Information:
{{banner.description}}
FIGURE: 1 / 1
SIX3 Antibody (PA5-95466) in WB
Western blot analysis of SIX3 in Lane 1: rat brain tissue lysate, Lane 2: mouse brain tissue lysate. Electrophoresis was performed with 5-20% SDS-PAGE gel (70V, Stacking gel; 90V Resolving gel, Time: 2-3 hours), transferred to a nitrocellulose membrane and blocked using 5% Non-fat Milk/TBS (1.5 hrs at room temperature). Samples were incubated with SIX3 polyclonal antibody (Product # PA5-95466) using a 0.5 µg/mL dilution, followed by a goat anti-rabbit IgG-HRP at a dilution of 1:10,000, and developed with enhanced chemiluminescence (ECL).
Please note: We are reviewing Western blot images included in the antibody testing data in our catalog, including those provided by third parties. Unless expressly labeled or annotated as “raw-unedited”, Western blot images included in the antibody testing data in our catalog may have been edited, optimized or otherwise adjusted for presentation.
Product Details
PA5-95466
Product Specifications
Species Reactivity
Human,
Mouse,
Rat
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human Six3 (1-32aa MVFRSPLDLYSSHFLLPNFADSHHRSILLASS).
Conjugate
Unconjugated
Unconjugated
Unconjugated
Form
Lyophilized
Concentration
500 µg/mL
Amount
100 µg
Purification
Affinity chromatography
Storage buffer
PBS with 4mg trehalose
Contains
0.05mg sodium azide
Storage conditions
-20°C
Shipping conditions
Ambient (domestic); Wet ice (international)
RRID
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Positive Control - WB: rat brain tissue, mouse brain tissue.|Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.
Target Information
This gene encodes a member of the sine oculis homeobox transcription factor family. The encoded protein plays a role in eye development. Mutations in this gene have been associated with holoprosencephaly type 2.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: Homeobox protein SIX3; Sine oculis homeobox homolog 3; sine oculis-related homeobox 3 homolog
Gene Aliases: E130112M24Rik; Six3; Six3a; Six3alpha; Six3b; Six3beta
UniProt ID: (Mouse) Q62233
Entrez Gene ID: (Mouse) 20473, (Rat) 78974
RNA polymerase II distal enhancer sequence-specific DNA binding
transcriptional activator activity, RNA polymerase II distal enhancer sequence-specific binding
transcription corepressor binding
DNA binding
transcription factor activity, sequence-specific DNA binding
transcription factor activity, RNA polymerase II distal enhancer sequence-specific binding
transcription coactivator activity
receptor binding
protein binding
histone deacetylase binding
sequence-specific DNA binding
homeodomain transcription factor
protein import into nucleus, translocation
eye development
epithelial cell maturation
lens development in camera-type eye
optic vesicle morphogenesis
transcription, DNA-templated
regulation of transcription, DNA-templated
transcription from RNA polymerase II promoter
protein import into nucleus
multicellular organism development
brain development
proximal/distal axis specification
neuroblast differentiation
diencephalon development
telencephalon development
forebrain anterior/posterior pattern specification
forebrain dorsal/ventral pattern formation
cell proliferation in forebrain
telencephalon regionalization
pituitary gland development
negative regulation of Wnt signaling pathway
regulation of cell proliferation
camera-type eye development
negative regulation of neuron differentiation
negative regulation of transcription, DNA-templated
positive regulation of transcription from RNA polymerase II promoter
circadian behavior
lens induction in camera-type eye
regulation of neural retina development
lens fiber cell differentiation
neuroblast migration
regulation of cell cycle phase transition
regulation of neuroblast proliferation
apoptotic process involved in development
lens fiber cell apoptotic process
regulation of neural precursor cell proliferation
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support