Search
Invitrogen
hnRNP A1 Polyclonal Antibody
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
FIGURE: 1 / 13
hnRNP A1 Antibody (PA5-79381) in ICC/IF
Immunocytochemistry/Immunofluorescence analysis of hnRNP A1 in U20S cells using hnRNP A1 Polyclonal Antibody (Product # PA5-79381). Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent for 15 mins. The cells were blocked with 10% goat serum and incubated with the primary antibody at 2 µg/mL. DyLight 550 conjugated goat anti-rabbit IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filt... View More
Please note: We are reviewing Western blot images included in the antibody testing data in our catalog, including those provided by third parties. Unless expressly labeled or annotated as “raw-unedited”, Western blot images included in the antibody testing data in our catalog may have been edited, optimized or otherwise adjusted for presentation.
Product Details
PA5-79381
Applications
Tested Dilution
Publications
Product Specifications
Species Reactivity
Human,
Mouse,
Rat
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human HnRNP A1 (8-42aa KEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTD).
Conjugate
Unconjugated
Unconjugated
Unconjugated
Form
Lyophilized
Concentration
500 µg/mL
Amount
100 µg
Purification
Antigen affinity chromatography
Storage buffer
PBS with 4mg trehalose
Contains
0.05mg sodium azide
Storage conditions
-20°C
Shipping conditions
Ambient (domestic); Wet ice (international)
RRID
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Positive Control - WB: human HepG2 whole cell, human Daudi whole cell, human MOLT-4 whole cell, human HL-60 whole cell. IHC: mouse intestine tissue, mouse kidney tissue, rat kidney tissue, human intestinal cancer tissue, human placenta tissue. ICC/IF: U20S cell, A431 cell. Flow: K562 cell.
Target Information
HnRNP A1 belongs to the A/B subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre mRNAs in the nucleus and appear to influence pre mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. hnRNP A1 has two repeats of quasi RRM domains that bind to RNAs. It is one of the most abundant core proteins of hnRNP complexes and it is localized to the nucleoplasm. This protein, along with other hnRNP proteins, is exported from the nucleus, probably bound to mRNA, and is immediately re imported.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: epididymis secretory sperm binding protein; HDP; helix destabilizing protein; helix-destabilizing protein; heterogeneous nuclear ribonucleoprotein A1B protein; heterogeneous nuclear ribonucleoprotein B2 protein; heterogeneous nuclear ribonucleoprotein core protein A1; hnRNP A1-like 3; hnRNP core protein A1; hnRNP core protein A1-like 3; hnRNP I; HNRNP-I; HNRNPI; HNRPA1MGC102835; HNRPI; MGC102835; nuclear ribonucleoprotein particle A1 protein; pPTB; PTB; PTB-1; PTB-T; PTB2; PTB3; PTB4; putative heterogeneous nuclear ribonucleoprotein A1-like 3; RP11-78J21.1; single-strand DNA-binding protein UP1; single-strand RNA-binding protein; single-strand-binding protein; TIS; topoisomerase-inhibitor suppressed; unnamed protein product
Gene Aliases: ALS19; ALS20; Hdp; HDP-1; hnRNP A1; hnRNP-A1; HNRPA1; HNRPA1L3; IBMPFD3; MPD3; UP 1
UniProt ID: (Human) P09651, (Rat) P04256, (Mouse) P49312
Entrez Gene ID: (Human) 3178, (Rat) 29578, (Mouse) 15382
nucleic acid binding
DNA binding
single-stranded DNA binding
RNA binding
single-stranded RNA binding
mRNA 3'-UTR binding
protein binding
protein domain specific binding
miRNA binding
pre-mRNA binding
identical protein binding
telomeric repeat-containing RNA binding
G-rich strand telomeric DNA binding
mRNA binding
RNA strand annealing activity
DNA/DNA annealing activity
sequence-specific mRNA binding
alternative mRNA splicing, via spliceosome
regulation of alternative mRNA splicing, via spliceosome
mRNA splicing, via spliceosome
RNA splicing
male gonad development
positive regulation of gene expression
RNA metabolic process
lung development
negative regulation of telomere maintenance via telomerase
positive regulation of telomere maintenance via telomerase
response to endoplasmic reticulum stress
cellular response to potassium ion
cellular response to glucose starvation
regulation of RNA splicing
positive regulation of action potential
nuclear export
nuclear import
cellular response to epidermal growth factor stimulus
cellular response to sodium arsenite
RNA export from nucleus
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support